PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA008605-PA
Common NameOsI_08025
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 332aa    MW: 34926.9 Da    PI: 4.9272
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA008605-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.31.6e-083067438
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....Ht 38
                      r C+ ++ + ++l+C+ ++ +lC+ C    H g    H 
  BGIOSGA008605-PA 30 RACDSCGGEAARLYCRADGAFLCARCDARAH-GagsrHA 67
                      57**************************999.4466675 PP

2zf-B_box22.91.8e-0769113341
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                        + C+ +e+ ++   C+ +   lC+ C   +H+       H++ p
  BGIOSGA008605-PA  69 VWLCEVCEHAPAAVTCRADAAALCAACDADIHSAnplarrHERLP 113
                       679*****************************6688888898877 PP

3CCT70.44.5e-24261304144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k++
  BGIOSGA008605-PA 261 REARLMRYREKRKNRRFDKTIRYASRKAYAETRPRIKGRFAKRT 304
                       9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8932771IPR000315B-box-type zinc finger
SMARTSM003365.4E-92771IPR000315B-box-type zinc finger
CDDcd000211.01E-93071No hitNo description
PfamPF006439.0E-73167IPR000315B-box-type zinc finger
PROSITE profilePS5011910.42467114IPR000315B-box-type zinc finger
PfamPF006437.9E-669114IPR000315B-box-type zinc finger
SMARTSM003364.6E-972114IPR000315B-box-type zinc finger
PfamPF062032.7E-18261303IPR010402CCT domain
PROSITE profilePS5101716.916261303IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEAVEDKAMV GVGGAVAAGY SSSSWGLGTR ACDSCGGEAA RLYCRADGAF LCARCDARAH  60
GAGSRHARVW LCEVCEHAPA AVTCRADAAA LCAACDADIH SANPLARRHE RLPVAPFFGP  120
LADAPQPFTF SQAAADAAGA REEDADDDRS NEAEAASWLL PEPDDNSHED SAAAADAFFA  180
DTGAYLGVDL DFARSMDGIK AIGVPVAPPE LDLTAGSLFY PEHSMAHSLS SSEVAIVPDA  240
LSAGAAAPPM VVVVASKGKE REARLMRYRE KRKNRRFDKT IRYASRKAYA ETRPRIKGRF  300
AKRTADADDD DEAPCSPAFS ALAASDGVVP SF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.157570.0flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329685540.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000970.0AK100097.1 Oryza sativa Japonica Group cDNA clone:J023004D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625855.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA2X7340.0A2X734_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA008605-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.17e-44CONSTANS-like 3